Total number of results for Procambarus bouvieri are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00726 |
QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV
|
72 | Procambarus bouvieri | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 8735961#Aguilar M.B., Falchetto R., Shabanowitz J., Hunt D.F., Huberman A.; #Complete primary structure of the molt-inhibiting hormone (MIH) of the Mexican crayfish Procambarus bouvieri (Ortmann).; #Peptides 17:367-374(1996). |